PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA8G00136
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MIKC_MADS
Protein Properties Length: 208aa    MW: 24019 Da    PI: 9.8434
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA8G00136genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.46.6e-27958150
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
               krien  nr vtfskRrng+lKKA+E+ vLCda+va+iif+s+gk+++y+
  AA8G00136  9 KRIENANNRVVTFSKRRNGLLKKAKEITVLCDAKVALIIFASNGKMHDYC 58
               79***********************************************7 PP

2K-box80.44.2e-2771167197
      K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                yqk sgk+l++ak+e+l++e++++kke+++Lq e+Rhl+Ged++sL+lk+L+ +e++++++l k++++K e++++  ++l++ e+e+ + + +L+++
  AA8G00136  71 YQKLSGKKLWDAKHENLSNEIDRIKKENDSLQLELRHLKGEDIQSLNLKNLMAVEHAIQHGLDKVKDHKVEFIMARRRNLKMIEEEQGQLHFQLQQQ 167
                899********************************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.5E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.314161IPR002100Transcription factor, MADS-box
CDDcd002651.38E-39280No hitNo description
SuperFamilySSF554552.49E-34296IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.5E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-273859IPR002100Transcription factor, MADS-box
PfamPF014861.9E-1482166IPR002487Transcription factor, K-box
PROSITE profilePS5129712.64684170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MGRGKIEIKR IENANNRVVT FSKRRNGLLK KAKEITVLCD AKVALIIFAS NGKMHDYCCP  60
SMDLGAMLDQ YQKLSGKKLW DAKHENLSNE IDRIKKENDS LQLELRHLKG EDIQSLNLKN  120
LMAVEHAIQH GLDKVKDHKV EFIMARRRNL KMIEEEQGQL HFQLQQQGMA IASNARGMMM  180
REHDAQFGYR VQPIQPNLQE KIMSLVIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-16289180Myocyte-specific enhancer factor 2A
3kov_B2e-16289180Myocyte-specific enhancer factor 2A
3kov_I2e-16289180Myocyte-specific enhancer factor 2A
3kov_J2e-16289180Myocyte-specific enhancer factor 2A
3p57_A2e-16289180Myocyte-specific enhancer factor 2A
3p57_B2e-16289180Myocyte-specific enhancer factor 2A
3p57_C2e-16289180Myocyte-specific enhancer factor 2A
3p57_D2e-16289180Myocyte-specific enhancer factor 2A
3p57_I2e-16289180Myocyte-specific enhancer factor 2A
3p57_J2e-16289180Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010420863.11e-138PREDICTED: floral homeotic protein PISTILLATA
SwissprotP480071e-139PIST_ARATH; Floral homeotic protein PISTILLATA
TrEMBLA0A0D3B2281e-138A0A0D3B228_BRAOL; Uncharacterized protein
TrEMBLS5YL221e-138S5YL22_BRAOV; PI.b
STRINGAT5G20240.11e-137(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.11e-131MIKC_MADS family protein